PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00130.1.g00290.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 382aa    MW: 41740.8 Da    PI: 7.9322
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00130.1.g00290.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.41.1e-130103811374
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.......s 74 
                                   lv+lLl+cA++vs+gd+  a + L  l+  asp gd+mqR+a+yf+ ALaarl+ s +  +++ +p+  +          s
  Zjn_sc00130.1.g00290.1.am.mk  10 LVHLLLACADFVSKGDQPSALRHLHLLRSVASPLGDSMQRVASYFADALAARLTLSANPSSSSSTPRGRTAGVapypfppS 90 
                                   68****************************************************97777777666666655447999**9* PP

                          GRAS  75 seelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgsk 155
                                    e+l++++++++++P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+     +
  Zjn_sc00130.1.g00290.1.am.mk  91 PETLKIYQILYQACPYIKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PA 167
                                   ***************************************************************************....88 PP

                          GRAS 156 eeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsP 236
                                    +++etg+ L+++A++l+vpfef++ va++le l++++L+ + gEalaVn v +lhr++   ++l      +L+++++  P
  Zjn_sc00130.1.g00290.1.am.mk 168 AAVRETGRHLSSLAASLRVPFEFHAAVADKLERLRPNALQRHVGEALAVNAVNRLHRVP--GAHLG----PLLSMIRDQAP 242
                                   **********************************************************9..44444....5********** PP

                          GRAS 237 kvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                                   k++++veqea hn++ Fl rfleal+yysa+fdsl+a++p++s  r+kvE+ ll++ei+nvvacegaer++rhe+l +Wr+
  Zjn_sc00130.1.g00290.1.am.mk 243 KIMTLVEQEAGHNGPYFLGRFLEALHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRR 323
                                   ********************************************************************************* PP

                          GRAS 318 rleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                    +e  GF+pvpls  a+ q + ll  ++ +dgyr+ e++g+l+lgW+dr+++++SaWr
  Zjn_sc00130.1.g00290.1.am.mk 324 LMEGQGFEPVPLSPAAVGQSQVLLGLYGaGDGYRLTEDKGCLLLGWQDRAIIAASAWR 381
                                   *********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.4591360IPR005202Transcription factor GRAS
PfamPF035143.8E-12810381IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MQEQDSGLQL VHLLLACADF VSKGDQPSAL RHLHLLRSVA SPLGDSMQRV ASYFADALAA  60
RLTLSANPSS SSSTPRGRTA GVAPYPFPPS PETLKIYQIL YQACPYIKFA HFTANQAIFE  120
AFHGEDRVHV VDLDILQGYQ WPAFLQALAA RPGGPPTLRL TGVGHPAAAV RETGRHLSSL  180
AASLRVPFEF HAAVADKLER LRPNALQRHV GEALAVNAVN RLHRVPGAHL GPLLSMIRDQ  240
APKIMTLVEQ EAGHNGPYFL GRFLEALHYY SAIFDSLDAT FPADSAPRMK VEQCLLAPEI  300
RNVVACEGAE RVARHERLDR WRRLMEGQGF EPVPLSPAAV GQSQVLLGLY GAGDGYRLTE  360
DKGCLLLGWQ DRAIIAASAW RC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-62103814375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450783.10.0hypothetical protein SORBIDRAFT_05g018070
TrEMBLC5Y2P60.0C5Y2P6_SORBI; Putative uncharacterized protein Sb05g018070
STRINGSb05g018070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-103RGA-like 1